Recombinant Mouse Epidermal growth factor-like protein 8 (Egfl8)

Product Description

Recombinant Mouse Epidermal growth factor-like protein 8 (Egfl8) is available at Gentaur for Next week Delivery.

Gene Name: Egfl8

Alternative Names : Ng3

Expression Region : 29-293aa

AA Sequence : GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 49 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interacting selectively and non-covalently with calcium ions (Ca2+).

Function :

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Ubiquitously expressed in brain, kidney, thymus and lung.

Paythway :

Uniprot ID : Q6GUQ1