Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Epididymal-specific lipocalin-5 (Lcn5) is available at Gentaur for Next week Delivery.
Gene Name: Lcn5
Alternative Names : Epididymal retinoic acid-binding protein Short name: E-RABP Short name: mE-RABP Epididymal secretory protein 10 Short name: MEP 10 Cleaved into the following 2 chains: Epididymal-specific lipocalin-5, major form Epididymal-specific lipocalin-5, minor form
Expression Region : 27-192aa
AA Sequence : TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.
Function : Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Calycin superfamily, Lipocalin family
Tissue Specificity : Epididymal fluid of the caudal and corpus regions (at protein level).
Paythway :
Uniprot ID : A2AJB7
