Product Description
Recombinant Mouse Fibroblast growth factor 17 (Fgf17) (Active) is available at Gentaur for Next week Delivery.
Gene Name: Fgf17
Alternative Names : Fibroblast growth factor 17; FGF-17;fgf17
Expression Region : 23-216aa
AA Sequence : TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
Sequence Info : Full Length of Mature Protein
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 23.7 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : FGF-17 is a member of the fibroblast growth factor (FGF) family. FGFs share 30 70% amino acid (aa) identity in a conserved, approximately 120 amino acid core domain. FGFs play multiple roles in biological functions, including angiogenesis, mitogenesis, cell differentiation and wound repair. FGF17 plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. It is also expressed in hindgut, parts of the developing skeleton, tail bud, major arteries, and heart. In many of these areas, it is expressed along with FGF-8, but slightly later. It is required for normal brain development.
Function : Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Heparin-binding growth factors family
Tissue Specificity :
Paythway :
Uniprot ID : P63075
Euro
British Pound
US Dollar