Product Description
Recombinant Mouse Fibroblast growth factor 9 (Fgf9) (Active) is available at Gentaur for Next week Delivery.
Gene Name: Fgf9
Alternative Names : Fibroblast growth factor 9;FGF-9;Glia-activating factor;GAF;heparin-binding growth factor-9;HBGF-9;Fgf9;Fgf-9
Expression Region : 1-208aa
AA Sequence : MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Sequence Info : Full Length
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 24.4 kDa
Storage Buffer : 0.2 ?m filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 10 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Fibroblast growth factor-9 (FGF-9) is an approximately 26 kDa secreted glycoprotein of the FGF family. Secreted mouse FGF-9 lacks the N-terminal 1-3 aa and shares >98% sequence identity with rat, human, equine, porcine and bovine FGF-9. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In the mouse embryo the location and timing of FGF-9 expression affects development of the skeleton, cerebellum, lungs, heart, vasculature, digestive tract, and testes .It may have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Deletion of mouse FGF-9 is lethal at birth due to lung hypoplasia, and causes rhizomelia, or shortening of the proximal skeleton. An unusual constitutive dimerization of FGF 9 buries receptor interaction sites which lowers its activity, and increases heparin affinity which inhibits diffusion. A spontaneous mouse mutant, Eks, interferes with dimerization, resulting monomeric, diffusible FGF-9 that causes elbow and knee synostoses (joint fusions) due to FGF-9 misexpression in developing joints.
Function : Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Heparin-binding growth factors family
Tissue Specificity :
Paythway :
Uniprot ID : P54130
Euro
British Pound
US Dollar