Product Description
Recombinant Mouse Galectin-4 (Lgals4) is available at Gentaur for Next week Delivery.
Gene Name: Lgals4
Alternative Names : Gal-4 Alternative name(s): Lactose-binding lectin 4
Expression Region : 1-326aa
AA Sequence : MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 38.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Tags & Cell Markers
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Galectin that binds lactose and a related range of sugars.
Function : Galectin that binds lactose and a related range of sugars.
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity : Epithelial cells of the embryonic and adult gastrointestinal tract. Expressed at about equal levels in colon and small intestine but much less in stomach.
Paythway :
Uniprot ID : Q8K419
Euro
British Pound
US Dollar