Recombinant Mouse Galectin-4 (Lgals4)

Product Description

Recombinant Mouse Galectin-4 (Lgals4) is available at Gentaur for Next week Delivery.

Gene Name: Lgals4

Alternative Names : Gal-4 Alternative name(s): Lactose-binding lectin 4

Expression Region : 1-326aa

AA Sequence : MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 38.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Galectin that binds lactose and a related range of sugars.

Function : Galectin that binds lactose and a related range of sugars.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity : Epithelial cells of the embryonic and adult gastrointestinal tract. Expressed at about equal levels in colon and small intestine but much less in stomach.

Paythway :

Uniprot ID : Q8K419