Product Description
Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial is available at Gentaur for Next week Delivery.
Gene Name: Glp1r
Alternative Names : Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Expression Region : 22-145aa
AA Sequence : GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 30.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Function : G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)
Involvement in disease :
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : G-protein coupled receptor 2 family
Tissue Specificity : Detected in pancreatic islets (at protein level). Detected in pancreatic islets and lungs.
Paythway :
Uniprot ID : O35659
Euro
British Pound
US Dollar