Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) (Active)

Product Description

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) (Active) is available at Gentaur for Next week Delivery.

Gene Name: Csf2

Alternative Names : Granulocyte-macrophage colony-stimulating factor;Csf2;GM-CSF;Colony-stimulating factor;Csfgm

Expression Region : 18-141aa

AA Sequence : APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 14.2 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using PDC-P1 cells is less than 100 pg/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factorthat can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by anumber of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cellsand fibroblasts) in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophageprogenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. Onmature hematopoietic, monocytes/ macrophages and eosinophils. GM-CSF has a functional role on nonhematopoitic cells. It can induce human endothelial cells to migrate and proliferate. Additionally, GM-CSF canalso stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma andadenocarcinoma cell lines.

Function : Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Involvement in disease :

Subcellular location : Secreted

Protein Families : GM-CSF family

Tissue Specificity :

Paythway :

Uniprot ID : P01587