Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial

Product Description

Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial is available at Gentaur for Next week Delivery.

Gene Name: Cxcl1

Alternative Names : C-X-C motif chemokine 1;Platelet-derived growth factor-inducible protein KCSecretory protein N51

Expression Region : 29-96aa

AA Sequence : NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation . Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hatopoietic activity.1 Publication

Function : Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation (By similarity). Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity :

Paythway :

Uniprot ID : P12850