Recombinant Mouse H-2 class I histocompatibility antigen, K-D alpha chain (H2-K1), partial

Product Description

Recombinant Mouse H-2 class I histocompatibility antigen, K-D alpha chain (H2-K1), partial is available at Gentaur for Next week Delivery.

Gene Name: H2-K1

Alternative Names :

Expression Region : 22-305aa

AA Sequence : GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT

Sequence Info : Extracellular Domain

Tag Info : N-terminal GST-tagged

Theoretical MW : 60 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the presentation of foreign antigens to the immune syst.

Function : Involved in the presentation of foreign antigens to the immune system.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : MHC class I family

Tissue Specificity :

Paythway :

Uniprot ID : P01902