Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial

Product Description

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial is available at Gentaur for Next week Delivery.

Gene Name: Cd74

Alternative Names : Ia antigen-associated invariant chain;IiMHC class II-associated invariant chain; CD74

Expression Region : 56-279aa

AA Sequence : QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 29.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Function : Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P04441