Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)

Product Description

Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2) is available at Gentaur for Next week Delivery.

Gene Name: Hbb-b2

Alternative Names : Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chain

Expression Region : 2-147aa

AA Sequence : VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in oxygen transport from the lung to the various peripheral tissues.

Function : Involved in oxygen transport from the lung to the various peripheral tissues.

Involvement in disease :

Subcellular location :

Protein Families : Globin family

Tissue Specificity : Red blood cells.

Paythway :

Uniprot ID : P02089