Recombinant Mouse Heparin-binding growth factor 2 protein (Fgf-2)

Product Description

Recombinant Mouse Heparin-binding growth factor 2 protein (Fgf-2) is available at Gentaur for Next week Delivery.

Gene Name: Fgf-2

Alternative Names : Basic fibroblast growth factor;bFGFHeparin-binding growth factor 2;HBGF-2

Expression Region : 10-154aa

AA Sequence : PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 20.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro .

Function : Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.

Involvement in disease :

Subcellular location : Secreted, Nucleus

Protein Families : Heparin-binding growth factors family

Tissue Specificity :

Paythway :

Uniprot ID : P15655