Recombinant Mouse Homeobox protein OTX2 (Otx2)

Product Description

Recombinant Mouse Homeobox protein OTX2 (Otx2) is available at Gentaur for Next week Delivery.

Gene Name: Otx2

Alternative Names : Orthodenticle homolog 2 (Otx-2)

Expression Region : 1-289aa

AA Sequence : MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 37.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence: 5'-TCTAATCCC-3'.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P80206