Recombinant Mouse Integrin alpha-L (Itgal), partial

Product Description

Recombinant Mouse Integrin alpha-L (Itgal), partial is available at Gentaur for Next week Delivery.

Gene Name: Itgal

Alternative Names : CD11 antigen-like family member ALeukocyte adhesion glycoprotein LFA-1 alpha chain;LFA-1ALeukocyte function-associated molecule 1 alpha chain;Lymphocyte antigen 15;Ly-15; CD11a

Expression Region : 153-325aa

AA Sequence : DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 21.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.

Function : Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : Integrin alpha chain family

Tissue Specificity : Leukocytes.

Paythway :

Uniprot ID : P24063