Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial

Product Description

Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial is available at Gentaur for Next week Delivery.

Gene Name: Icam4

Alternative Names : CD_antigen: CD242

Expression Region : 23-231aa

AA Sequence : QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 39.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.

Function : Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.

Involvement in disease :

Subcellular location : Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted

Protein Families : Immunoglobulin superfamily, ICAM family

Tissue Specificity :

Paythway :

Uniprot ID : Q9ERM2