Recombinant Mouse Interleukin-1 beta (Il1b) (Active)

Product Description

Recombinant Mouse Interleukin-1 beta (Il1b) (Active) is available at Gentaur for Next week Delivery.

Gene Name: Il1b

Alternative Names : Interleukin-1 Beta; IL-1 Beta; Il1b

Expression Region : 118-269aa

AA Sequence : VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 17.4 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 50 mM Tris-HCl, 50 mM NaCl, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-1 (IL-1) designates two proteins, IL-1? and IL-1?, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1? and IL-1? are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1?, designated interleukin 1?-converting enzyme (ICE), has been described. Mature human and mouse IL-1? share approximately 75% amino acid sequence identity and human IL-1? has been found to be active on murine cell lines.

Function : Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Lysosome, Secreted, exosome, Cytoplasmic vesicle, autophagosome, Secreted

Protein Families : IL-1 family

Tissue Specificity : Expressed in activated macrophages (at protein level).

Paythway :

Uniprot ID : P10749