Recombinant Mouse Interleukin-10 (Il10) (Active)

Product Description

Recombinant Mouse Interleukin-10 (Il10) (Active) is available at Gentaur for Next week Delivery.

Gene Name: Il10

Alternative Names : Interleukin-10;Il10;IL-10;Cytokine synthesis inhibitory factor;CSIF;

Expression Region : 19-178aa

AA Sequence : SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 18.9 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mouse Il10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. Many viruses encode viral members of the IL-10 family, such as Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV).Its main function is inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Although human and mouse IL-10 are 81% identical at the nucleotide and amino acid level, mouse IL-10 is species-specific and does not act on human cells. Interestingly, Human IL-10 is active on mouse cells.

Function : Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-10 family

Tissue Specificity :

Paythway :

Uniprot ID : P18893