Product Description
Recombinant Mouse Interleukin-13 (Il13), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: Il13
Alternative Names : Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13
Expression Region : 26-131aa
AA Sequence : SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Sequence Info : Partial
Tag Info : Tag-Free
Theoretical MW : 11.7 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 10 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13R?1 with low affinity and triggers association of IL4R?, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13R?2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.
Function : Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages
Involvement in disease :
Subcellular location : Secreted
Protein Families : IL-4/IL-13 family
Tissue Specificity :
Paythway :
Uniprot ID : P20109
Euro
British Pound
US Dollar