Product Description
Recombinant Mouse Interleukin-7 (Il7) (Active) is available at Gentaur for Next week Delivery.
Gene Name: Il7
Alternative Names : IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF
Expression Region : 26-154aa
AA Sequence : ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Sequence Info : Full Length of Mature Protein
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 15.9 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 5 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mouse interleukin-7(IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all naïve and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction.
Function : Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Involvement in disease :
Subcellular location : Secreted
Protein Families : IL-7/IL-9 family
Tissue Specificity :
Paythway :
Uniprot ID : P10168
Euro
British Pound
US Dollar