Recombinant Mouse Kinesin-like protein KIF1A (Kif1a), partial

Product Description

Recombinant Mouse Kinesin-like protein KIF1A (Kif1a), partial is available at Gentaur for Next week Delivery.

Gene Name: Kif1a

Alternative Names : Axonal transporter of synaptic vesicles

Expression Region : 1-361aa

AA Sequence : MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIIN

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 56.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Motor for anterograde axonal transport of synaptic vesicle precursors.

Function : Motor for anterograde axonal transport of synaptic vesicle precursors.

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton

Protein Families : TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Unc-104 subfamily

Tissue Specificity : Expressed almost exclusively in adult brain tissue (mainly in the cerebellum and cerebrum) within a single type of neuronal cell. Within the neuronal cell levels are concentrated around the axon, with smaller amounts in the perinuclear and synaptic regions.

Paythway :

Uniprot ID : P33173