Product Description
Recombinant Mouse Leukocyte surface antigen CD47 (Cd47), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: Cd47
Alternative Names : Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
Expression Region : 19-158aa
AA Sequence : QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP
Sequence Info : Partial of Isoform 2
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 16.7 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : CD47, also known as Integrin?Associated Protein (IAP) and OA3, is a glycosylated atypical member of the immunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellular domain (ECD) with a single Ig?like domain, five membrane-spanning regions with short intervening loops, and C?terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. It plays an important role in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cellcell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. It may play a role in membrane transport and/or integrin dependent signal transduction. It also prevents premature elimination of red blood cells.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q61735-2
Euro
British Pound
US Dollar