Recombinant Mouse Lithostathine-1 (Reg1)

Product Description

Recombinant Mouse Lithostathine-1 (Reg1) is available at Gentaur for Next week Delivery.

Gene Name: Reg1

Alternative Names : Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1

Expression Region : 22-165aa

AA Sequence : QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 32.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Might act as an inhibitor of spontaneous calcium carbonate precipitation.

Function : Might act as an inhibitor of spontaneous calcium carbonate precipitation.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver.

Paythway :

Uniprot ID : P43137