Recombinant Mouse Major urinary protein 11 (Mup11)

Product Description

Recombinant Mouse Major urinary protein 11 (Mup11) is available at Gentaur for Next week Delivery.

Gene Name: Mup11

Alternative Names : Mup9

Expression Region : 1-151aa

AA Sequence : REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 23.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Major urinary proteins bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance. Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole in vitro .

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P04938