Product Description
Recombinant Mouse Major urinary protein 2 (Mup2) is available at Gentaur for Next week Delivery.
Gene Name: Mup2
Alternative Names :
Expression Region : 19-180aa
AA Sequence : EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 20.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
Function : Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Calycin superfamily, Lipocalin family
Tissue Specificity : Abundant in the urine of adult male mice but absent from that of females.
Paythway :
Uniprot ID : P11589
Euro
British Pound
US Dollar