Product Description
Recombinant Mouse Major urinary proteins 11 and 8 (Mup11) is available at Gentaur for Next week Delivery.
Gene Name: Mup11
Alternative Names : MUP11 and MUP8
Expression Region : 1-151aa
AA Sequence : REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 19.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
Function : Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro
Involvement in disease :
Subcellular location : Secreted
Protein Families : Calycin superfamily, Lipocalin family
Tissue Specificity :
Paythway :
Uniprot ID : P04938
Euro
British Pound
US Dollar