Product Description
Recombinant Mouse Membrane cofactor protein (Cd46), partial is available at Gentaur for Next week Delivery.
Gene Name: Cd46
Alternative Names : CD46
Expression Region : 45-329aa
AA Sequence : CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 35.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
Function : May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
Involvement in disease :
Subcellular location : Isoform 1: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity : Present only in testis (at protein level).
Paythway :
Uniprot ID : O88174