Recombinant Mouse Mesothelin (Msln), partial

Product Description

Recombinant Mouse Mesothelin (Msln), partial is available at Gentaur for Next week Delivery.

Gene Name: Msln

Alternative Names : Pre-pro-megakaryocyte-potentiating factor

Expression Region : 298-600aa

AA Sequence : DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 36.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mbrane-anchored forms may play a role in cellular adhesion.

Function : Membrane-anchored forms may play a role in cellular adhesion.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Golgi apparatus, SUBCELLULAR LOCATION: Megakaryocyte-potentiating factor: Secreted

Protein Families : Mesothelin family

Tissue Specificity : Highly expressed in lung and heart. Expressed at low levels in spleen, liver, kidney and testis. Present in lung (at protein level).

Paythway :

Uniprot ID : Q61468