Recombinant Mouse Monoglyceride lipase (Mgll)

Product Description

Recombinant Mouse Monoglyceride lipase (Mgll) is available at Gentaur for Next week Delivery.

Gene Name: Mgll

Alternative Names : Short name: MGL Alternative name(s): Monoacylglycerol lipase Short name: MAGL

Expression Region : 1-303aa

AA Sequence : MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 35.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:9341166, PubMed:17700715, PubMed:18096503, PubMed:19029917, PubMed:20729846). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (By similarity).

Function : Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Membrane, Peripheral membrane protein

Protein Families : AB hydrolase superfamily, Monoacylglycerol lipase family

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : O35678