Product Description
Recombinant Mouse Myoglobin (Mb) is available at Gentaur for Next week Delivery.
Gene Name: Mb
Alternative Names :
Expression Region : 2-154aa
AA Sequence : GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 20.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Function : Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Involvement in disease :
Subcellular location :
Protein Families : Globin family
Tissue Specificity :
Paythway :
Uniprot ID : P04247
Euro
British Pound
US Dollar