Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl)

Product Description

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl) is available at Gentaur for Next week Delivery.

Gene Name: Nrl

Alternative Names :

Expression Region : 1-237aa

AA Sequence : MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 46.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.

Function : Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : BZIP family

Tissue Specificity : Expressed in the retina (at protein level) (PubMed:11477108).

Paythway :

Uniprot ID : P54846