Product Description
Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r), partial is available at Gentaur for Next week Delivery.
Gene Name: Npy2r
Alternative Names : NPY-Y2 receptor (Y2 receptor)
Expression Region : 1-51aa
AA Sequence : MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV
Sequence Info : Extracellular Domain
Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 25.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for neuropeptide Y and peptide YY.
Function : Receptor for neuropeptide Y and peptide YY.
Involvement in disease :
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : G-protein coupled receptor 1 family
Tissue Specificity :
Paythway :
Uniprot ID : P97295
Euro
British Pound
US Dollar