Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1) is available at Gentaur for Next week Delivery.
Gene Name: Nmes1
Alternative Names :
Expression Region : 1-83aa
AA Sequence : MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
Sequence Info : Full Length
Tag Info : C-terminal Flag-Myc-tagged
Theoretical MW : 12.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Nucleus
Protein Families : Complex I NDUFA4 subunit family
Tissue Specificity : Strongly expressed in vertebrae, brain, intestine and stomach.
Paythway :
Uniprot ID : Q810Q5
