Product Description
Recombinant Mouse Oncomodulin (Ocm) is available at Gentaur for Next week Delivery.
Gene Name: Ocm
Alternative Names : Parvalbumin beta
Expression Region : 2-109aa
AA Sequence : SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 14.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Function : Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Involvement in disease :
Subcellular location :
Protein Families : Parvalbumin family
Tissue Specificity : Found in tumor tissues and not detected in normal tissues.
Paythway :
Uniprot ID : P51879