Product Description
Recombinant Mouse Osteocalcin (Bglap) is available at Gentaur for Next week Delivery.
Gene Name: Bglap
Alternative Names : Bone Gla protein Short name: BGP Gamma-carboxyglutamic acid-containing protein
Expression Region : 50-95aa
AA Sequence : YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 21.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Function : Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Osteocalcin/matrix Gla protein family
Tissue Specificity : Bone.
Paythway :
Uniprot ID : P86546
Euro
British Pound
US Dollar