Product Description
Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial is available at Gentaur for Next week Delivery.
Gene Name: Plaa
Alternative Names : PLA2P (PLAP) (Plap)
Expression Region : 495-584aa
AA Sequence : TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
Sequence Info : Partial
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 13.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development. Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha - or lipopolysaccharide -dependent manner, and hence prostaglandin E2 biosynthesis.
Function : Plays a role in protein ubiquitination, sorting and degradation through its association with VCP (By similarity). Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling
Involvement in disease :
Subcellular location : Nucleus, Cytoplasm, Cell junction, synapse
Protein Families : WD repeat PLAP family
Tissue Specificity : Expressed in the brain, with highest levels in hippocampal neurons, cerebellar granular cell layer and Purkinje cells (PubMed:28413018).
Paythway :
Uniprot ID : P27612
Euro
British Pound
US Dollar