Recombinant Mouse Proprotein convertase subtilisin/kexin type 5 (Pcsk5), partial

Product Description

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5 (Pcsk5), partial is available at Gentaur for Next week Delivery.

Gene Name: Pcsk5

Alternative Names : Proprotein convertase 5 Short name: PC5 Proprotein convertase 6 Short name: PC6 Subtilisin-like proprotein convertase 6 Short name: SPC6 Subtilisin/kexin-like protease PC5

Expression Region : 117-452aa

AA Sequence : DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 38.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors (By similarity).

Function : Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive and regulated secretory pathways. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.

Involvement in disease :

Subcellular location : Isoform PC5A: Secreted, Note=Secreted through the regulated secretory pathway, SUBCELLULAR LOCATION: Isoform PC5B: Endomembrane system, Single-pass type I membrane protein

Protein Families : Peptidase S8 family

Tissue Specificity : PC5A is expressed in most tissues but is most abundant in the intestine and adrenals. PC5B is expressed in the intestine, adrenals and lung but not in the brain.

Paythway :

Uniprot ID : Q04592