Recombinant Mouse Reactive oxygen species modulator 1 (Romo1)

Product Description

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1) is available at Gentaur for Next week Delivery.

Gene Name: Romo1

Alternative Names : Protein MGR2 homolog (ROS modulator 1)

Expression Region : 1-79aa

AA Sequence : MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 11.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage.Induces production of reactive oxygen species which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P60603