Recombinant Mouse Resistin (Retn)

Product Description

Recombinant Mouse Resistin (Retn) is available at Gentaur for Next week Delivery.

Gene Name: Retn

Alternative Names : Adipose tissue-specific secretory factor;ADSFAdipose-specific cysteine-rich secreted protein A12-alpha;Cysteine-rich secreted protein FIZZ3

Expression Region : 21-114aa

AA Sequence : SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 14.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.

Function : Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Resistin/FIZZ family

Tissue Specificity : Expressed in white but not brown adipose tissue in a variety of organs.

Paythway :

Uniprot ID : Q99P87