Recombinant Mouse Serine protease 29 (Prss29)

Product Description

Recombinant Mouse Serine protease 29 (Prss29) is available at Gentaur for Next week Delivery.

Gene Name: Prss29

Alternative Names : Implantation serine proteinase 2;ISP-2Strypsin-2Strypsin-related protein;Tryptase-like proteinase

Expression Region : 18-279aa

AA Sequence : GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 43.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in bryo hatching and implantation.

Function : Involved in embryo hatching and implantation.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Peptidase S1 family

Tissue Specificity : Expressed in embryos and placenta. Found in uterus especially in glandular epithelium during zona lysis and implantation.

Paythway :

Uniprot ID : Q99MS4