Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1)

Product Description

Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1) is available at Gentaur for Next week Delivery.

Gene Name: Spink1

Alternative Names : P12;Prostatic secretory glycoprotein

Expression Region : 24-80aa

AA Sequence : AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 8.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.

Function : Serine protease inhibitor which exhibits anti-trypsin activity

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity : In the genital tract, expressed only in male accessory glands including seminal vesicle, coagulating gland and prostate.

Paythway :

Uniprot ID : P09036