Product Description
Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1) is available at Gentaur for Next week Delivery.
Gene Name: Spink1
Alternative Names : P12;Prostatic secretory glycoprotein
Expression Region : 24-80aa
AA Sequence : AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 8.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.
Function : Serine protease inhibitor which exhibits anti-trypsin activity
Involvement in disease :
Subcellular location : Secreted
Protein Families :
Tissue Specificity : In the genital tract, expressed only in male accessory glands including seminal vesicle, coagulating gland and prostate.
Paythway :
Uniprot ID : P09036
Euro
British Pound
US Dollar