Recombinant Mouse Sonic hedgehog protein (Shh), partial (Active)

Product Description

Recombinant Mouse Sonic hedgehog protein (Shh), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: Shh

Alternative Names : Sonic Hedgehog Protein; SHH; HHG-1; SHH

Expression Region : 25-198aa

AA Sequence : CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 19.8 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH). Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa N­terminal fragment (Shh­N), and a catalytic­processing,glycosylated, 34 kDa, 239 aa C­terminal fragment. The 20 kDa Shh­N fragment is the core of the active hedgehog molecule. Mouse Shh­N is 99%, 98%, and 100% aa identical to human, rat and gerbil Shh­N, respectively.

Function : Sonic hedgehog protein

Involvement in disease :

Subcellular location : Sonic hedgehog protein N-product: Cell membrane, Lipid-anchor

Protein Families : Hedgehog family

Tissue Specificity : Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina.

Paythway :

Uniprot ID : Q62226