Euro
British Pound
US Dollar
Product Description
Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial is available at Gentaur for Next week Delivery.
Gene Name: Cd3e
Alternative Names : Alternative name(s): T-cell surface antigen T3/Leu-4 epsilon chain CD_antigen: CD3e
Expression Region : 23-108aa
AA Sequence : DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 11.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : The CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. Required for normal immune responses.
Function : Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell developement
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P22646
