Recombinant Mouse Tenomodulin (Tnmd), partial

Product Description

Recombinant Mouse Tenomodulin (Tnmd), partial is available at Gentaur for Next week Delivery.

Gene Name: Tnmd

Alternative Names : Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)

Expression Region : 51-317aa

AA Sequence : KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 34.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be an angiogenesis inhibitor.

Function : May be an angiogenesis inhibitor.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein, Nucleus envelope

Protein Families : Chondromodulin-1 family

Tissue Specificity : Widely expressed with highest expression in tendons and ligaments, in the diaphragm, eye and skeletal muscle. Expressed in neuronal cells of all brain regions. Very low expression, if any, in glial cells.

Paythway :

Uniprot ID : Q9EP64