Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12)

Product Description

Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) is available at Gentaur for Next week Delivery.

Gene Name: Txndc12

Alternative Names : Endoplasmic reticulum resident protein 19 Short name: ER protein 19 Short name: ERp19 Thioredoxin-like protein p19

Expression Region : 25-170aa

AA Sequence : RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 18.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Possesses significant protein thiol-disulfide oxidase activity.

Function : Possesses significant protein thiol-disulfide oxidase activity.

Involvement in disease :

Subcellular location : Endoplasmic reticulum lumen

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q9CQU0