Product Description
Recombinant Mouse Thy-1 membrane glycoprotein (Thy1) is available at Gentaur for Next week Delivery.
Gene Name: Thy1
Alternative Names : Thy-1 antigen CD_antigen: CD90
Expression Region : 20-131aa
AA Sequence : QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 28.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Function : May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P01831
Euro
British Pound
US Dollar