Recombinant Mouse Thy-1 membrane glycoprotein (Thy1)

Product Description

Recombinant Mouse Thy-1 membrane glycoprotein (Thy1) is available at Gentaur for Next week Delivery.

Gene Name: Thy1

Alternative Names : Thy-1 antigen CD_antigen: CD90

Expression Region : 20-131aa

AA Sequence : QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 28.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Function : May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P01831