Recombinant Mouse Transforming growth factor beta-1 (Tgfb1) (Active)

Product Description

Recombinant Mouse Transforming growth factor beta-1 (Tgfb1) (Active) is available at Gentaur for Next week Delivery.

Gene Name: Tgfb1

Alternative Names : TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP;latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1

Expression Region : 279-390aa

AA Sequence : ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 12.8 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 4 mM HCl

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF?1 human erythroleukemic cells is less than 1 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transforming growth factor beta 1 (TGF?1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF-?1, TGF-?2 and TGF-?3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-? receptor type II (T?R-II), and a TGF-? receptor type I (T?R-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-? expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

Function : Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : TGF-beta family

Tissue Specificity :

Paythway :

Uniprot ID : P04202