Recombinant Mouse Transmembrane protease serine 4 (Tmprss4), partial

Product Description

Recombinant Mouse Transmembrane protease serine 4 (Tmprss4), partial is available at Gentaur for Next week Delivery.

Gene Name: Tmprss4

Alternative Names : Channel-activating protease 2;mCAP2

Expression Region : 52-435aa

AA Sequence : KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 57.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable protease. Ses to be capable of activating ENaC.

Function : Probable protease. Seems to be capable of activating ENaC.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families : Peptidase S1 family

Tissue Specificity :

Paythway :

Uniprot ID : Q8VCA5