Recombinant Mouse TSC22 domain family protein 4 (Tsc22d4)

Product Description

Recombinant Mouse TSC22 domain family protein 4 (Tsc22d4) is available at Gentaur for Next week Delivery.

Gene Name: Tsc22d4

Alternative Names : TSC22-related-inducible leucine zipper protein 2 Thg-1pit

Expression Region : 1-387aa

AA Sequence : MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 42 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transcriptional repressor.

Function : Transcriptional repressor.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : TSC-22/Dip/Bun family

Tissue Specificity :

Paythway :

Uniprot ID : Q9EQN3