Recombinant Mouse Uroplakin-2 (Upk2)

Product Description

Recombinant Mouse Uroplakin-2 (Upk2) is available at Gentaur for Next week Delivery.

Gene Name: Upk2

Alternative Names : Uroplakin II

Expression Region : 85-184aa

AA Sequence : ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-GST-tagged

Theoretical MW : 40.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.

Function : Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : Uroplakin-2 family

Tissue Specificity :

Paythway :

Uniprot ID : P38575