Recombinant Mycobacterium tuberculosis ESAT-6-like protein EsxH (esxH), partial

Product Description

Recombinant Mycobacterium tuberculosis ESAT-6-like protein EsxH (esxH), partial is available at Gentaur for Next week Delivery.

Gene Name: esxH

Alternative Names : 10KDA antigen CFP7;CFP-7Low molecular weight protein antigen 7Protein TB10.4

Expression Region : 2-96aa

AA Sequence : SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 26.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.

Involvement in disease :

Subcellular location : Secreted

Protein Families : WXG100 family, ESAT-6 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P9WNK2