Product Description
Recombinant Mycobacterium tuberculosis ESAT-6-like protein EsxH (esxH), partial is available at Gentaur for Next week Delivery.
Gene Name: esxH
Alternative Names : 10KDA antigen CFP7;CFP-7Low molecular weight protein antigen 7Protein TB10.4
Expression Region : 2-96aa
AA Sequence : SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 26.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.
Involvement in disease :
Subcellular location : Secreted
Protein Families : WXG100 family, ESAT-6 subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P9WNK2
Euro
British Pound
US Dollar